<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19636
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNKLQKQPQQRPNPQPQVNSQIPAEALELIRNRLSQVHQLLRKLADQINLHNRNPAKVKLPSYLNLQLQFQVLITQLQTIAARLDSNDEVLKATNVYPLPAFPTTQQEGLVTTLLRKKPLPEVDEWIDAAIAESDQFKLPIHTDDDFAEWCYAKVKELEDEFTFEGFHSEKELEFMETEEGQKSEKARKDAEEEKEKLASEISGGKTPMSPNVVLRFMSRGVLQ |
| Length | 224 |
| Position | Head |
| Organism | [Candida] pseudohaemulonis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.670 |
| Instability index | 50.72 |
| Isoelectric point | 5.28 |
| Molecular weight | 25701.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19636
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.44| 23| 23| 124| 146| 1
---------------------------------------------------------------------------
124- 146 (41.42/28.87) DEWIDAAIAE.SDQFKL.PIHTDDD
148- 172 (34.01/22.60) AEWCYAKVKElEDEFTFeGFHSEKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.21| 12| 144| 59| 70| 2
---------------------------------------------------------------------------
43- 54 (20.47/13.56) KLADQINLHNRN
59- 70 (20.74/13.81) KLPSYLNLQLQF
---------------------------------------------------------------------------
|