Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MNKLQKQPQQRPNPQPQVNSQIPAEALELIRNRLSQVHQLLRKLADQINLHNRNPAKVKLPSYLNLQLQFQVLITQLQTIAARLDSNDEVLKATNVYPLPAFPTTQQEGLVTTLLRKKPLPEVDEWIDAAIAESDQFKLPIHTDDDFAEWCYAKVKELEDEFTFEGFHSEKELEFMETEEGQKSEKARKDAEEEKEKLASEISGGKTPMSPNVVLRFMSRGVLQ |
Length | 224 |
Position | Head |
Organism | [Candida] pseudohaemulonis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.670 |
Instability index | 50.72 |
Isoelectric point | 5.28 |
Molecular weight | 25701.89 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19636 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.44| 23| 23| 124| 146| 1 --------------------------------------------------------------------------- 124- 146 (41.42/28.87) DEWIDAAIAE.SDQFKL.PIHTDDD 148- 172 (34.01/22.60) AEWCYAKVKElEDEFTFeGFHSEKE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.21| 12| 144| 59| 70| 2 --------------------------------------------------------------------------- 43- 54 (20.47/13.56) KLADQINLHNRN 59- 70 (20.74/13.81) KLPSYLNLQLQF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKEKLA 2) FMSRGVL | 194 217 | 199 223 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab