<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19635

Description Serine/threonine-protein kinase SSN3
SequenceMYPHGVSRLNRPGAGQNFPQPYYSTNNVPNAPTSASSMQLPQPTMMALNSILTLGPYRHRKDLSRNSVLSNYTVIGYIAAGTYGKVYKAKLKVGKNSSSDDLGEMGRQLEKQETVEDHRLFAIKKFKLDNHSSMAHALGANNEGGAYTGISQSAIREMSLCRELNHKNITKLMEIMLESKSIYMVFEFFEHDLLQIIHYHLHPDVKPIPETTVKSLIWQVLNGVTFLHKNWVFHRDLKPANIMVSSDGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWYRAPELLLGTRHYTPAIDLWAVGCILAELLSLRPIFKGEEAKFDMSNKKLIPFQKNQLQKIFEILGTPTVEQWPSLPKYPDYYAFQQHFLQKGATYPPNLSNWYKMIGGKSKGCLTLLRDLLHYDPVTRVSADGALVHPYFLEAPLVKENAFEGLNVKYPKRRIFTDDIDITAQNNNFNNKRHYDDGASRKRQRG
Length474
PositionKinase
Organism[Candida] pseudohaemulonis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Metschnikowiaceae> Clavispora> Clavispora/Candida clade.
Aromaticity0.10
Grand average of hydropathy-0.406
Instability index41.43
Isoelectric point9.40
Molecular weight53888.29
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP19635
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.01|      19|      29|     332|     352|       2
---------------------------------------------------------------------------
  332-  352 (30.15/25.34)	FQKNQLQKifEILGTPTVEQW
  364-  382 (37.86/24.45)	FQQHFLQK..GATYPPNLSNW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.36|      12|      19|      10|      21|       5
---------------------------------------------------------------------------
   10-   21 (24.92/13.33)	NRP..GAGQNFPQP
   30-   43 (18.45/ 8.31)	NAPtsASSMQLPQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.22|      42|     108|     285|     328|       6
---------------------------------------------------------------------------
  285-  328 (68.45/46.32)	LLLGTRHYTPAIDLWAVGCILAELLSLRPIFKgeEAKFDMSNKK
  396-  437 (71.77/42.70)	LLRDLLHYDPVTRVSADGALVHPYFLEAPLVK..ENAFEGLNVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.83|      15|      27|      53|      67|       7
---------------------------------------------------------------------------
   53-   67 (27.46/17.64)	TLGP.YRHRKDLSRNS
   82-   97 (21.37/12.22)	TYGKvYKAKLKVGKNS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP19635 with CDK8 domain of Kingdom Fungi

Unable to open file!