<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19628
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAAQAPPAAQQAPQQQALYPPPPPFYRLYRPGADGSVDAPLPPPPVEGAYQQFGIADSTEVVLPPLTGRQLFEAGPDGAIDFRGELLALHRELVAQVLELLAVLTDKPSMWARQVENTSAVLRNMQHLCNLLRPVQARQTLLHTLRGELEQRQAAAQELRDVAAAADAALAGSAEELAAAAAALQQAAEAAGGVAAANGAG |
| Length | 201 |
| Position | Middle |
| Organism | Micractinium conductrix |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae>
Chlorellales> Chlorellaceae> Chlorella clade> Micractinium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.075 |
| Instability index | 41.47 |
| Isoelectric point | 4.81 |
| Molecular weight | 21017.54 |
| Publications | PubMed=29178410
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19628
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.14| 19| 19| 20| 38| 1
---------------------------------------------------------------------------
20- 38 (39.54/17.83) P.PPPPFYRLYRP.GADGSVD
40- 60 (26.14/ 9.78) PlPPPPVEGAYQQfGIADSTE
63- 81 (32.46/13.58) L.PPLTGRQLFEA.GPDGAID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.83| 22| 23| 145| 166| 2
---------------------------------------------------------------------------
145- 166 (35.90/19.14) LRGELEQRQAAAQELRDVAAAA
170- 191 (33.93/17.66) LAGSAEELAAAAAALQQAAEAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.72| 17| 23| 97| 114| 3
---------------------------------------------------------------------------
97- 114 (26.32/19.21) VLELLAVLTD........KPsMWARQ
115- 139 (22.40/11.58) VENTSAVLRNmqhlcnllRP.VQARQ
---------------------------------------------------------------------------
|