<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19618

Description Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
SequenceMAFEMSLPHAPRIRVVAPDGGETHAEDEAQWALYYSVQRALQEQQDGQAPAEGEGGEEGGKAAAAKAPQPSDPQKVLSKLLTARGELDVITDLVTFVEQQQFLAVEGIHRPPPTLEERTRARALRLAAARQQLHGAAGLLGRGLAALQAQAAVDDRFLADLSQLRRRWKLRRHAGAGPGAAGLFYADISLPLRGALARAVSQEGVQCNIIQDTNGDACIVEAAAPGGKRQAVRGWRHIHAVLEAKQALLAWRVMGQLLAAAARLPQHEADPDGAVAALQRLAAAAAADAQAAVHRAVASAPQAAGAAAASMDVDANGEQQQSEAAAALAAPASLPAGMLSSAAQDLQAALSSPGFQQQFEARALLLLSHLLTGGSSSGASAVTAADAETAQQALLAGLLRWLRHAAACQRPLATMTEFTKVIPASCLRGSGLLLTPEFRDAVVPETGTYTLQNAEGKQTTCTITRKAQGAHERCDIHGGWRQFARDNEIKEGDEVRIRHLGGRVIEITKTGRTGTPGRTPAKAAKTPGRSRASGSGSKTPRTAEGGVAKRRSSSSAKKAKPAAAAGTPASPASGRRGRRSSQGAASAARAARAAPAEDDWQGQQEQAAGSSGWCSLAGWAVALYRVGGHVIATRSLEGAYTVAGDVVGCFQLASALEILHAALGLVGGSPLTALMQWAGRSNVLFGVVAAVPEVQNRPAVGAMFLAWALSEIIRYPWYAASLAGACPHWLTWLRYTAFIGLYPVGVLGEMKSVFDALPFIKARGLRSLALPNAANWGFDYHTFLVVLLCLYPFLWFRLYAFLFRQRRKKLGAPAAVAGSKKRE
Length823
PositionHead
OrganismChlorella sorokiniana (Freshwater green alga)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae> Chlorellales> Chlorellaceae> Chlorella clade> Chlorella.
Aromaticity0.06
Grand average of hydropathy-0.092
Instability index51.68
Isoelectric point9.69
Molecular weight86589.52
Publications
PubMed=29178410

Function

Annotated function Catalyzes the third of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of two carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each cycle of fatty acid elongation. Thereby, it participates to the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. 
ECO:0000256	RuleBase:RU363109
GO - Cellular Component
endoplasmic reticulum membrane	GO:0005789	IEA:UniProtKB-SubCell
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
GO - Biological Function
3-hydroxy-arachidoyl-CoA dehydratase activity	GO:0102343	IEA:UniProtKB-EC
3-hydroxy-behenoyl-CoA dehydratase activity	GO:0102344	IEA:UniProtKB-EC
3-hydroxy-lignoceroyl-CoA dehydratase activity	GO:0102345	IEA:UniProtKB-EC
DNA binding	GO:0003677	IEA:UniProtKB-KW
very-long-chain 3-hydroxyacyl-CoA dehydratase activity	GO:0102158	IEA:UniProtKB-EC
GO - Biological Process
fatty acid biosynthetic process	GO:0006633	IEA:UniProtKB-UniPathway

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP19618
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.97|      17|      21|     269|     288|       1
---------------------------------------------------------------------------
  284-  305 (15.82/ 8.76)	AAAADaqAAVHRavaSAPQAAG
  593-  609 (29.16/10.67)	AAPAE..DDWQG...QQEQAAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.13|      15|      15|     230|     244|       2
---------------------------------------------------------------------------
  230-  244 (27.87/14.88)	QAVRGWRHIHAVLEA
  246-  260 (26.26/13.61)	QALLAWRVMGQLLAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.63|      14|      15|     322|     335|       3
---------------------------------------------------------------------------
  322-  335 (23.71/11.87)	SEAAAALAAPASLP
  340-  353 (22.92/11.20)	SSAAQDLQAALSSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.32|      13|      15|     624|     636|       4
---------------------------------------------------------------------------
  624-  636 (23.39/15.49)	YRVGGHVIATRSL
  640-  652 (23.93/16.03)	YTVAGDVVGCFQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     259.46|      70|     230|     121|     194|       5
---------------------------------------------------------------------------
  121-  191 (118.15/44.23)	ARALRLAAARQQLHGAAGL.LGRGLAAL....................QAQAAVDDRFLA.D.LSQ.LRRRWKLRRHAGA..GPGAAGLFYADIsLP
  361-  423 (89.47/29.51)	ARALLLLS..HLLTGGSSS.GASAVTAA....................DAETA.QQALLA.GlL......RW.L.RHAAAcqRPLATMTEFTKV.IP
  653-  727 (51.84/15.07)	......ASALEILHAALGLvGGSPLTALmqwagrsnvlfgvvaavpevQNRPAVGAMFLAwA.LSEiIRYPWYAASLAGA..CP.............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      81.37|      20|      21|     529|     548|       6
---------------------------------------------------------------------------
  514-  528 (19.79/ 6.18)	.....GTPGRT.PAKAAKTPG
  529-  548 (33.71/16.60)	RSRASGSGSKT.PRTAEGGVA
  549-  569 (27.87/12.23)	KRRSSSSAKKAkPAAAAGTPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.74|      15|      21|     473|     492|       7
---------------------------------------------------------------------------
  473-  492 (22.37/30.96)	RCDiHGGWRQFardnEI.KEG
  496-  511 (23.36/13.93)	RIR.HLGGRVI....EItKTG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19618 with Med17 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QEQQDGQAPAEGEGGEEGGKAAAAKAPQPSDPQKVLS
2) RDNEIKEGDEVRIRHLGGRVIEITKTGRTGTPGRTPAKAAKTPGRSRASGSGSKTPRTAEGGVAKRRSSSSAKKAKPAAAAGTPASPASGRRGRRSSQGAASAARAARAAPAEDDWQGQQE
42
485
78
605










Molecular Recognition Features






MoRF SequenceStartStop




1) AKKAKPA
556
562