<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19614
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSGGELQQLQGAEQKLLSALQAAEQVVELLSSGARQAQLEELCARFLADVQDSQVALLQLAERHQQPLPFQNNDYRARLQLLAARKQAAAAEAQTAGAQQH |
| Length | 101 |
| Position | Head |
| Organism | Chlorella sorokiniana (Freshwater green alga) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae>
Chlorellales> Chlorellaceae> Chlorella clade> Chlorella.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.366 |
| Instability index | 55.76 |
| Isoelectric point | 5.24 |
| Molecular weight | 10976.19 |
| Publications | PubMed=29178410
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19614
No repeats found
No repeats found
|