<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19613
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAEPAEPRRADEEEVGCSGMRRFELELEFLHCLANPGYLNWLAQNRYFEDEAFLEYLKYLLYWRQPQYARFIVYPHALYFLDLLQTPEFRAKIANPAYKEMVHTQQFFFWQYARANRIKEKVAEDVAAAGAAAAGGQQAIAVKQEPLLPG |
| Length | 150 |
| Position | Middle |
| Organism | Chlorella sorokiniana (Freshwater green alga) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae>
Chlorellales> Chlorellaceae> Chlorella clade> Chlorella.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.343 |
| Instability index | 40.96 |
| Isoelectric point | 5.43 |
| Molecular weight | 17455.69 |
| Publications | PubMed=29178410
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19613
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.09| 25| 27| 71| 95| 1
---------------------------------------------------------------------------
27- 44 (24.53/12.02) .........LEFLHCLANPGYLNWLAQ
71- 95 (41.36/24.47) F..IVYPHALYFLDLLQTPEFRAKIAN
98- 124 (36.20/20.65) YkeMVHTQQFFFWQYARANRIKEKVAE
---------------------------------------------------------------------------
|