<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19609
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASGTESDEASDTPEIYKDPDDGRQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPDYTKFIMYPHCLFFLEQLQNANFRNAMAHPANKELAHRQQFYFWKNYRHNRLKHILPRPLPEPEAAPPVSAPPQQPVPALPPVPAATISATATAPALPPMQYANAPGSALAKNDARNSAVDRRKRKKEG |
| Length | 199 |
| Position | Middle |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.689 |
| Instability index | 61.56 |
| Isoelectric point | 8.45 |
| Molecular weight | 22860.63 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19609
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.32| 15| 15| 148| 162| 1
---------------------------------------------------------------------------
148- 162 (27.34/12.51) PALPPVPAATISATA
165- 179 (29.98/14.34) PALPPMQYANAPGSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.79| 16| 18| 57| 72| 2
---------------------------------------------------------------------------
33- 51 (24.38/11.99) FIQC...LanpTYIHYLAQNRY
57- 72 (32.67/17.90) FIGY...L...KYLQYWQRPDY
75- 93 (22.74/10.82) FIMYphcL...FFLEQLQNANF
---------------------------------------------------------------------------
|