Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLQPQIVQSPARLGLSNPNSPAFQNPTPPKLPLQQQPSSSASASSSSQHSNLSPSLVSLLSPLPRAQSLLVQMASLSSKLFEVSPNRSLWLNAFRGSFPTFLSSQTQSQFSIPLENCPSSTKDVLSQFTALQTQLFEAVAELQEILDLQDAKLKIAHEVRSKDVSLLTFSKKLKDVEQVLDNLVDDYSDLSRPKRVKLDDGSEDDSSCATTVSSQLNLSDILSYAHRISYTTFAPPEFGAGQAPLRGSLPPAPQEEHMRASQLYNFANLDVGLPKTVDSTEKTIEAIIEPPPPAPTEANQAPNFGALQGRLPPNITIPSGWKPGMPVELPTDFPMPPPGWKPGDPVPLPPVGSLPVPKVEDQHLRPKPQAMHKPQEPIQVMHVELDIPDQDDSSDYSSDEGSFEDDD |
Length | 407 |
Position | Middle |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.462 |
Instability index | 74.47 |
Isoelectric point | 4.73 |
Molecular weight | 44299.22 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19606 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 120.83| 30| 30| 317| 346| 1 --------------------------------------------------------------------------- 317- 346 (63.79/29.74) IPSGWKPGMPVELPTDFPMPPPGWKPGDPV 349- 378 (57.04/25.80) PPVGSLPVPKVEDQHLRPKPQAMHKPQEPI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 98.01| 26| 30| 29| 54| 2 --------------------------------------------------------------------------- 20- 52 (39.72/19.47) SP.................afqnptpPKLPLQQQPSSSASASSSSQHSNL 53- 83 (31.41/13.76) SP.................slvsllsP.LP.RAQSLLVQMASLSSKLFEV 84- 131 (26.89/10.66) SPnrslwlnafrgsfptflssqtqsqFSIPLENCPSSTKDV..LSQFTAL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 87.81| 24| 39| 250| 277| 3 --------------------------------------------------------------------------- 250- 277 (40.12/30.51) PPAPQEehmrASQLYNFANLDVGLPKTV 292- 315 (47.69/26.15) PPAPTE....ANQAPNFGALQGRLPPNI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AMHKPQEPIQVMHVELDIPDQD 2) YSSDEGSFEDDD | 370 396 | 391 407 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab