<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19606

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQPQIVQSPARLGLSNPNSPAFQNPTPPKLPLQQQPSSSASASSSSQHSNLSPSLVSLLSPLPRAQSLLVQMASLSSKLFEVSPNRSLWLNAFRGSFPTFLSSQTQSQFSIPLENCPSSTKDVLSQFTALQTQLFEAVAELQEILDLQDAKLKIAHEVRSKDVSLLTFSKKLKDVEQVLDNLVDDYSDLSRPKRVKLDDGSEDDSSCATTVSSQLNLSDILSYAHRISYTTFAPPEFGAGQAPLRGSLPPAPQEEHMRASQLYNFANLDVGLPKTVDSTEKTIEAIIEPPPPAPTEANQAPNFGALQGRLPPNITIPSGWKPGMPVELPTDFPMPPPGWKPGDPVPLPPVGSLPVPKVEDQHLRPKPQAMHKPQEPIQVMHVELDIPDQDDSSDYSSDEGSFEDDD
Length407
PositionMiddle
OrganismRosa chinensis (China rose)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa.
Aromaticity0.06
Grand average of hydropathy-0.462
Instability index74.47
Isoelectric point4.73
Molecular weight44299.22
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19606
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     120.83|      30|      30|     317|     346|       1
---------------------------------------------------------------------------
  317-  346 (63.79/29.74)	IPSGWKPGMPVELPTDFPMPPPGWKPGDPV
  349-  378 (57.04/25.80)	PPVGSLPVPKVEDQHLRPKPQAMHKPQEPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.01|      26|      30|      29|      54|       2
---------------------------------------------------------------------------
   20-   52 (39.72/19.47)	SP.................afqnptpPKLPLQQQPSSSASASSSSQHSNL
   53-   83 (31.41/13.76)	SP.................slvsllsP.LP.RAQSLLVQMASLSSKLFEV
   84-  131 (26.89/10.66)	SPnrslwlnafrgsfptflssqtqsqFSIPLENCPSSTKDV..LSQFTAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.81|      24|      39|     250|     277|       3
---------------------------------------------------------------------------
  250-  277 (40.12/30.51)	PPAPQEehmrASQLYNFANLDVGLPKTV
  292-  315 (47.69/26.15)	PPAPTE....ANQAPNFGALQGRLPPNI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19606 with Med4 domain of Kingdom Viridiplantae
Unable to open file!