<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19592
| Description |
Putative transcription regulator MED6 family |
| Sequence | MATPPPNMEGGPPQVVAQPPGTDMTGICFKDQLWLSSYPLDRNLVFDYFAISPFYDWTCNNEQLRQRAIHPLDISHLSKMTGTEYMLTEVTEPHLFVIRKQKRDSPEKVTPMMTYYVLDGSIYQAPQLCNVFAARVGRALYHITKAFTTASSNLEKIGYVDPENETAASESKASKETIDVREFNRVNQILQSLLRKLPPAPPPPPFPEGYVPVPTGEAENGSETQQAGEPQQPPVDPIIDQGPAKRMKY |
| Length | 249 |
| Position | Head |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.524 |
| Instability index | 59.05 |
| Isoelectric point | 5.31 |
| Molecular weight | 27882.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19592
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.99| 22| 196| 2| 26| 1
---------------------------------------------------------------------------
2- 26 (41.51/23.69) ATPPPNMeggPPQVVAQPPGTDMTG
200- 221 (44.48/19.12) APPPPPF...PEGYVPVPTGEAENG
---------------------------------------------------------------------------
|