| Description | Putative transcription regulator MED6 family |
| Sequence | MATPPPNMEGGPPQVVAQPPGTDMTGICFKDQLWLSSYPLDRNLVFDYFAISPFYDWTCNNEQLRQRAIHPLDISHLSKMTGTEYMLTEVTEPHLFVIRKQKRDSPEKVTPMMTYYVLDGSIYQAPQLCNVFAARVGRALYHITKAFTTASSNLEKIGYVDPENETAASESKASKETIDVREFNRVNQILQSLLRKLPPAPPPPPFPEGYVPVPTGEAENGSETQQAGEPQQPPVDPIIDQGPAKRMKY |
| Length | 249 |
| Position | Head |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.524 |
| Instability index | 59.05 |
| Isoelectric point | 5.31 |
| Molecular weight | 27882.35 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19592
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.99| 22| 196| 2| 26| 1
---------------------------------------------------------------------------
2- 26 (41.51/23.69) ATPPPNMeggPPQVVAQPPGTDMTG
200- 221 (44.48/19.12) APPPPPF...PEGYVPVPTGEAENG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PVDPIIDQGPAKRMKY 2) QILQSLLRKLP | 234 188 | 249 198 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab