| Description | Uncharacterized protein |
| Sequence | MCGGRASIELGEIVVTQLYFRHNKPCLWKFLDFCLSSGLLSPLRVLSLLSARVIPQRLSQPEAYRLFLELLRWYAFSFGPPAPDGHKKKFSGGIIG |
| Length | 96 |
| Position | Tail |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.180 |
| Instability index | 58.39 |
| Isoelectric point | 9.66 |
| Molecular weight | 10810.65 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP19586 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) KKFSGG 2) YRLFLELLRWYAFSFG | 88 64 | 93 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab