Description | Uncharacterized protein |
Sequence | MCGGRASIELGEIVVTQLYFRHNKPCLWKFLDFCLSSGLLSPLRVLSLLSARVIPQRLSQPEAYRLFLELLRWYAFSFGPPAPDGHKKKFSGGIIG |
Length | 96 |
Position | Tail |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
Aromaticity | 0.12 |
Grand average of hydropathy | 0.180 |
Instability index | 58.39 |
Isoelectric point | 9.66 |
Molecular weight | 10810.65 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19586 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KKFSGG 2) YRLFLELLRWYAFSFG | 88 64 | 93 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab