<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19583
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MRVRIQESLGARVGKLSHDKKKAIEEEEELLSYTADVLPSLEEQEVRQLYPKGPNIDFKKELRSLNRELQLHIFELADILVERPSQYARRVEEISLIFQNLHHRLNSLRPHQARVTLIHILELQTKRHKQAVEDIQRPRYY |
Length | 141 |
Position | Middle |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.704 |
Instability index | 74.23 |
Isoelectric point | 8.89 |
Molecular weight | 16810.08 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19583
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 137.90| 37| 39| 56| 94| 1
---------------------------------------------------------------------------
20- 49 (37.80/17.94) ...KK..KAIE..EEEE.....LLSYT.ADVL...PSLEEQEVRQL
56- 94 (56.75/34.57) IDFKKELRSLN..RELQ.....LHIFELADILveRPSQYARRVEEI
96- 135 (43.35/21.38) LIFQNLHHRLNslRPHQarvtlIHILEL......QTKRHKQAVEDI
---------------------------------------------------------------------------
|