Description | "Putative mediator complex, subunit Med21" |
Sequence | MDAISQLQEQVNKIATIAFTTIGTLQRDAPPVRISPNYPESESAPPPNPNPNLTDDATDFAMQPKLMSADLVKAAKQFDALVSALPLSEGGEEAQMKRIAELQAENSLVGQQLEKQLEAAERELEEVRELFGQAADHCLNLKKPE |
Length | 145 |
Position | Middle |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.497 |
Instability index | 54.09 |
Isoelectric point | 4.52 |
Molecular weight | 15852.66 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule polar nucleus GO:0043078 IEA:EnsemblPlants |
GO - Biological Function | |
GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants |
Binary Interactions |
Repeats | >MDP19574 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.51| 18| 19| 101| 118| 1 --------------------------------------------------------------------------- 101- 118 (28.57/18.21) ELQAENSLVGQQLEKQLE 123- 140 (29.94/19.37) ELEEVRELFGQAADHCLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AQMKRIAELQ 2) LTDDATDFAMQPKLMSADLVK | 94 53 | 103 73 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab