<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19556
| Description |
"Putative coactivator CBP, KIX domain-containing protein" |
| Sequence | MEIKAQPMQKPTRGTTENKIQPLISAKSTRKVHGPVLYTNAGFVCNYRNEVKVTKKLVKFSDQRPPQGGEALNGARDWRIYLMPDSRQRIVRRCKTDVLKRHLPFSGQGGLLERQRIATRFEDKLYATASSQSDYLQKISLKLLAIETAGVATSPPSNLKRHRALAFERD |
| Length | 170 |
| Position | Tail |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.672 |
| Instability index | 43.24 |
| Isoelectric point | 10.34 |
| Molecular weight | 19293.06 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.81| 17| 20| 129| 147| 2
---------------------------------------------------------------------------
129- 147 (22.17/18.75) ASSQSDYLQKisLKLLAIE
152- 168 (29.64/18.27) ATSPPSNLKR..HRALAFE
---------------------------------------------------------------------------
|