<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19552

Description "Putative coactivator CBP, KIX domain-containing protein"
SequenceMKETYLPELSEMFQKIDNKLQEYESVPPQSNPDKLEKLKVFRTMLEHLITVLQVSKSNISPGLKEKLGLYEKQIINFINTNRPRKTVSSLHLPPPDMHNAHLLQQPKVEQQDQSASNLIPTQGQQSQPHPSQQQYLSNIQSQLIHIQQRQLSMQQQLIPLLQDMQQRHKASGQVSAAIIQPRNTMELQNQLYQSHTAIPETSSTSLDSPALTGHTDKRPIKRFMKYNDGSPPQGGEPAMDVGDWRSQLQADSRQRIVNKLMDLLKRHLPFSSQEGLDELKKISVRFEEKIYGAATSQSDYLRKISLKMITMETKSQNTMANSLQSNSAGNTYETCDSNSCNSILLFFIFSF
Length351
PositionTail
OrganismRosa chinensis (China rose)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa.
Aromaticity0.06
Grand average of hydropathy-0.705
Instability index65.62
Isoelectric point8.85
Molecular weight40033.02
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19552
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.65|      20|      20|     105|     124|       1
---------------------------------------------------------------------------
  105-  122 (28.64/13.45)	....QPKVEQQDQSASNLIPTQ
  123-  142 (31.03/15.16)	GQqsQPHPSQQ.QYLSN.IQSQ
  146-  159 (20.98/ 7.96)	IQ..QRQLSMQQQ....LIP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.12|      10|      19|     277|     286|       2
---------------------------------------------------------------------------
  277-  286 (17.19/10.60)	DELKKISVRF
  299-  308 (17.93/11.30)	DYLRKISLKM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.47|      13|      26|      29|      41|       3
---------------------------------------------------------------------------
   29-   41 (22.95/13.84)	QSN..PDKLEKLKVF
   56-   70 (18.52/ 9.95)	KSNisPGLKEKLGLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.00|      16|      25|     160|     175|       4
---------------------------------------------------------------------------
  160-  175 (27.32/16.54)	LLQDMQQRHKASGQVS
  187-  202 (27.68/16.86)	LQNQLYQSHTAIPETS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.11|      11|      25|     208|     218|       5
---------------------------------------------------------------------------
  208-  218 (20.67/12.57)	SPALTGHT.....DKR
  230-  245 (18.44/10.51)	SPPQGGEPamdvgDWR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.96|      13|      19|     310|     323|       6
---------------------------------------------------------------------------
  310-  323 (18.24/15.37)	TMETKSQNTmANSL
  331-  343 (25.72/16.08)	TYETCDSNS.CNSI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19552 with Med15 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KASGQVSAAIIQPRNTMELQNQLYQSHTAIPETSSTSLDSPALTGHTDKRPIKRFMKYNDGSPPQGGEPAMDVGDWRSQ
2) RKTVSSLHLPPPDMHNAHLLQQPKVEQQDQSASNLIPTQGQQSQPHPSQQQYLSNI
169
84
247
139










Molecular Recognition Features






MoRF SequenceStartStop




NANANA