<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19541

Description "Putative WW domain, FF domain-containing protein"
SequenceMANNPQSSAAQYRPMVPTQQGQHFISSAPQQFQPVGQGQPLQYSQQMQPYPLRPSQPGHAQPSSQALPMPYYQPRPVTSVPSHSQQPAPPFNNQMPGMPYPSSYMYAPPSFVQPQNNVSSSSQFQPMSQEQAHAVPAAGQPWMSSSNHQGAAVVTPQQQPSQQPTSTPFPDPAVNVPNLTQPSASDWQEHMATDGRRYYFNRSTRQSSWEKPLELMTPLERADASTVWKEYTSADGKKYYYNKVTRESKWTIPEELKLAREQAQRELNQGTQSEMNLTPHAPPATASAEIHAGASSVGPSTSSAQPGTVSSPVAVTPISAFSNPSPITPSGSLVAPGVQSSMATGSVGVQPAVVSVSPLPASNLGSTGVPSTLVNTNTKSVGNENQASQDIASSIDGAFTQDIEEAKKGMAVAGKVNVTPSEEKAIDDEPLVYASKQEAKNAFKSLLESANVHSDWTWEQAMREIINDKRYGALRTLGERKQAFNEYLGQRKKLENEERRIRQKRAREEFTKMLEESKELTSTIRWSKAVTMFENDERFKAVERARDREDLYESYIVELERKEKEYAAEEHRRNISEYREFLESCDFIKVNSQWRKVQDRLEDDERCLRLEKLDRLLIFQDYIRDLEKEEEEQKKMQKEQLRRIERKNRDEFRKLLEEHAADGTLTAKSQWRDYCMKVKDLPQYEAVALNTSGSTPKDLFEDVAEELEKQFLEDKARVKDAMKQGQIAMVSSWTFEEFKAAVVKDIGSPSIPELNLKLAYEEILERAKEKEEKEAKKRQRLADDFTKLLHTFKEITASSNWEDCKHLFEETQEYRSVGDENSGKEVFEEYITSLHEKAKEKERKREEEKAKKEKEREEKEKRKDKERKEKEREREKEKGKERSKKDETDSENVDLTDSHDHKEDKKREKDKDRKHRKRHQSSIDDVGSDKDEKEDSKKHRHSSDRKKSRKRAYTPESDSENRHRRHKREHRDGSRRNGGYEELEDGEVGEDGEIQ
Length995
PositionUnknown
OrganismRosa chinensis (China rose)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa.
Aromaticity0.07
Grand average of hydropathy-1.186
Instability index59.48
Isoelectric point6.09
Molecular weight114027.97
Publications









Function






Annotated function


GO - Cellular Component
cytosol	GO:0005829	IEA:EnsemblPlants
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19541
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     142.54|      16|      17|       7|      22|       1
---------------------------------------------------------------------------
    7-   22 (32.12/16.52)	SSA...AQ.YRPM.......VPT.QQGQ
   26-   39 (21.20/ 8.40)	SSA...PQqFQPV...........GQGQ
   44-   59 (28.40/13.76)	SQQ...MQ.PYPL.......RPS.QPGH
   64-   86 (18.98/ 6.75)	SQAlpmPY.YQPR...pvtsVPS.HSQQ
  101-  115 (20.88/ 8.16)	PSS...YM.YAP.........PSfVQPQ
  119-  140 (20.96/ 8.22)	SSS...SQ.FQPMsqeqahaVPA..AGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     163.39|      26|      27|     835|     860|       2
---------------------------------------------------------------------------
  627-  651 (23.23/ 7.06)	.EKE.EEEQKKM..QKEQLRriERKNR............DE..
  835-  860 (41.66/18.67)	HEKA.KEKERKR..EEEKAK..KEKER............EEKE
  863-  889 (36.84/15.64)	KDKErKEKERER..EKEKGK..ERSKK............DETD
  899-  934 (33.61/13.60)	HDH..KE.DKKR..EKDKDR..KHRKRhqssiddvgsdkDEKE
  941-  967 (28.05/10.10)	HSSD.RKKSRKRayTPESDS..ENRHR............RHK.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     135.52|      37|      38|     179|     215|       3
---------------------------------------------------------------------------
  179-  215 (72.59/46.54)	LTQPSASD.WQEHMATDGRRYYFNRSTRQSSWEKPLEL
  219-  256 (62.93/39.32)	LERADASTvWKEYTSADGKKYYYNKVTRESKWTIPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     404.52|      62|      65|     436|     497|       4
---------------------------------------------------------------------------
  436-  493 (83.31/49.65)	.........KQEAKN..A.........................FKSLL.ES.AN.VHSDWT....WEQAMREIINDKRYG..ALRTLGE.R...KQAFNEYLGQRKK
  494-  561 (78.76/46.53)	LENEerrirQKRARE..E.........................FTKMLeES.KE.LTSTIR....WSKAVTMFENDERFK..AVERARD.R...EDLYESYIVELER
  562-  625 (66.76/38.29)	KEKE..yaaEEHRRNisE.........................YREFL.ES.CDfIKVNSQ....WRKVQDRLEDDERCL..RLEKL.D.R...LLIFQDYI...RD
  626-  709 (45.59/23.73)	L.................ekeeeeqkkmqkeqlrrierknrdeFRKLL.EE.HA.ADGTLTaksqWRDYCMKVKDLPQYEavALNTSGStP...KDLFEDVAEELEK
  712-  769 (71.87/41.80)	LE.D.....KARVKD..A.........................MKQ.G.QI.AM.V.SSWT....FEEFKAAVVKDIGSP..SIPEL.N.L...KLAYEEILERAKE
  770-  831 (58.22/32.42)	KEEK.eakkRQRLAD..D.........................FTKLL.HTfKE.ITASSN....WEDCKHLFEETQEY.....RSVGD.EnsgKEVFEEYI.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      63.67|      17|      18|     305|     321|       5
---------------------------------------------------------------------------
  282-  303 (19.42/10.40)	PPATAS.AEIhagasSVGP..STSS
  305-  321 (28.61/19.37)	QPGTVS.SPV.....AVTP..ISAF
  323-  342 (15.65/ 6.72)	NPSPITpSGS.....LVAPgvQSSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.30|      13|      18|     145|     157|       7
---------------------------------------------------------------------------
  145-  157 (22.58/16.12)	SSNHQGAAVVTPQ
  166-  178 (24.72/18.47)	STPFPDPAVNVPN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19541 with Med35 domain of Kingdom Viridiplantae
Unable to open file!