<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19539
Description |
Uncharacterized protein |
Sequence | MEENEANASPSNPKTTQELAVEGQKHLEETIESAFQILSSMNDELCNPLLWSTNSSAAAAAATTANGHSSLSNGVVHSDSSSSDNTNTQNLGDSSGGGGPGNGGALEEARLRYKNSVTALRAVLAEIPNSQKATSETGSPADETEIEKLEEKASNLRKELVKKNAYIKVLIDQLRDLVTDISTWQSPCSV |
Length | 190 |
Position | Head |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.588 |
Instability index | 45.99 |
Isoelectric point | 4.64 |
Molecular weight | 20089.68 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19539
No repeats found
No repeats found
|