<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19526
Description |
Uncharacterized protein |
Sequence | MQYNSSKYDIQMALRDEIKSACDYRPFEKCDYSSRIANEICCKKLEYVMLKNSIDAKTTVRTLGTNCTMYLI |
Length | 72 |
Position | Head |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.436 |
Instability index | 43.89 |
Isoelectric point | 8.28 |
Molecular weight | 8420.69 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19526
No repeats found
No repeats found
|