Description | Uncharacterized protein |
Sequence | MTVTVSSVNKMPQLHNTDEAVPVTPGIQLVEVTAPASSETYTEVALAVSSFCEYLAPLLHLSKPGISTGVVPTAAAAVASLMSDGGGTTL |
Length | 90 |
Position | Head |
Organism | Rosa chinensis (China rose) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
Aromaticity | 0.03 |
Grand average of hydropathy | 0.442 |
Instability index | 47.31 |
Isoelectric point | 4.48 |
Molecular weight | 9100.29 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19522 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) EYLAPLLHL 2) PTAAAAVASLMSDGGG | 53 72 | 61 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab