| Description | Uncharacterized protein |
| Sequence | MTVTVSSVNKMPQLHNTDEAVPVTPGIQLVEVTAPASSETYTEVALAVSSFCEYLAPLLHLSKPGISTGVVPTAAAAVASLMSDGGGTTL |
| Length | 90 |
| Position | Head |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis> Rosa. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | 0.442 |
| Instability index | 47.31 |
| Isoelectric point | 4.48 |
| Molecular weight | 9100.29 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP19522 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) EYLAPLLHL 2) PTAAAAVASLMSDGGG | 53 72 | 61 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab