<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19514
| Description |
"Putative mediator complex, subunit Med25, von Willebrand factor type A" |
| Sequence | MHAGSLTRPSPWTRNVDGFLEGLSALHFSGGGGPNEAAIAGGLAEALVMFPKPTPTGTGTETETDQVQDHNARERHCILVAASNPVLFRTAVQIPIISNGQFSSGTQTRWTLADAQDVAKLYAECSVSLSVISPKQFPKLREIYNAVQITNTLFVLFLELN |
| Length | 161 |
| Position | Unknown |
| Organism | Rosa chinensis (China rose) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Rosoideae> Rosoideae incertae sedis>
Rosa.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.043 |
| Instability index | 37.30 |
| Isoelectric point | 5.75 |
| Molecular weight | 17309.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19514
No repeats found
No repeats found
|