<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19512
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MTELIHQLTQQTYYQLNQLTNSLHDRSGLERRALIVLFLNQTRIKFAKLMVAVKWALNNSYAPANGREEESNKDGTAGNFIINKSWDILRVIEAQDSLLRNAADSLYNLHSEVSERSAPIYDLTNAVDVLTTGAYKRLPLVIHKTIESPTITTPRDDEKKRVIDRLSRIIHLKLFSASIPSQFTEAYVLNGHAVCGVSREFRAHITLKGDTETEPWVISHLDIFVRSDPELTEESPNLQHPSFSKQIKEVNHLAQSRMSASSNPLHDLYEVVHAFCISLQLYILSHQCQKLSKIQPSLQLVSDGSDHSKKIVIKYWTSSSVTASNTPATSSQSGETSKSPPTLEISSSPSGLTLKHTPSITDPSNHSVPLMKPRSDRLNLGEILNHVINAYVQSRLTRAYESLRPTSGGFDFHSRSRLLPSEEDAHQLCLKIDLVKNSSLNVRIDRRTGLYSLKVEPPSFEEDFIKLLEDRINSMDVGEIKTVVRVSLNRKMVEYYESLAHSARLTTTRRLPKRSLVANANFTENALYIRLAQPHQDYFLVVEITEIFQQKLFLIRTKPNDEVTGLVNIEQVEALPDRHNGSIELKPLPIAACYRILNRMRE |
| Length | 602 |
| Position | Tail |
| Organism | Planoprotostelium fungivorum |
| Kingdom | Amoebozoa |
| Lineage | Eukaryota> Amoebozoa> Evosea> Variosea> Cavosteliida> Cavosteliaceae>
Planoprotostelium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.368 |
| Instability index | 52.09 |
| Isoelectric point | 8.38 |
| Molecular weight | 68187.74 |
| Publications | PubMed=29378020
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19512
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.04| 16| 25| 137| 154| 1
---------------------------------------------------------------------------
137- 154 (24.38/20.48) RLPLVIHKTIESPTIttP
165- 180 (27.66/16.37) RLSRIIHLKLFSASI..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 351.16| 101| 215| 181| 286| 2
---------------------------------------------------------------------------
181- 286 (168.37/110.25) SQFTEAY.....VLNGHAVCGVS.R....EFRAH.ITLKGDTETEPWVI....SHLDIFVRSDPELTEESPN...LQHPSFSK.Q.IKEV.NHL....AQSRMSAssnplHDLYEVVHAFCISL.....QLY.ILSH
305- 395 (78.26/41.59) SDHSKKI.....VIKYWTSSSVTaS....NTPAT.SSQSGETSKSPPTLeissSPSGLTLKHTPSITDPSNHsvpLMKPRSDRlN.LGEIlNHVinayVQSR...................................
397- 501 (104.53/59.65) ...TRAYeslrpTSGGFDFHSRS.RllpsEEDAHqLCLKID......LV....KNSSLNVRIDRRTGLYSLK...VEPPSFEE.DfIK.....L....LEDRINS.....MDVGEIKTVVRVSLnrkmvEYYeSLAH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.03| 21| 23| 527| 547| 3
---------------------------------------------------------------------------
527- 547 (34.73/26.14) LYIRLAQPHQDYFLVVEITEI
552- 572 (33.31/24.75) LFLIRTKPNDEVTGLVNIEQV
---------------------------------------------------------------------------
|