<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19508
| Description |
Srb7p: RNA polymerase II holoenzyme component |
| Sequence | MSSDRLTELQNQISELTFKFYTFLGIIQRDSPSVSLDTQLNHPPDSSEEDLLKFDTQTKDFAVQIAKSSRAIHDVRYSSDFPTQSSQLIQSLPGSSSTEEEQVKEMERLEEENQVESDKLKERVDKAEEQLNKIREMDY |
| Length | 139 |
| Position | Middle |
| Organism | Planoprotostelium fungivorum |
| Kingdom | Amoebozoa |
| Lineage | Eukaryota> Amoebozoa> Evosea> Variosea> Cavosteliida> Cavosteliaceae>
Planoprotostelium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.922 |
| Instability index | 62.32 |
| Isoelectric point | 4.51 |
| Molecular weight | 16080.47 |
| Publications | PubMed=29378020
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.85| 11| 17| 60| 73| 2
---------------------------------------------------------------------------
60- 73 (14.94/15.37) DFAVQiakSSRAIH
80- 90 (20.91/12.12) DFPTQ...SSQLIQ
---------------------------------------------------------------------------
|