<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19507
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MANTIRAQLHEILDEYSKLTLQIFSELSSGQAAAATDLMGKLIEKDKELNNAVKELKKHQEFQMKINQTIKDIEEKDKKITQVMQILRDAESILSAQVEEGRKQLKIREQSKQSAPFVDELVSYSHRISATTSAPPGWSDGQETFLYKFPAPMETEIRSGMLYSKEAEDLFKT |
Length | 173 |
Position | Middle |
Organism | Planoprotostelium fungivorum |
Kingdom | Amoebozoa |
Lineage | Eukaryota> Amoebozoa> Evosea> Variosea> Cavosteliida> Cavosteliaceae>
Planoprotostelium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.613 |
Instability index | 46.14 |
Isoelectric point | 5.52 |
Molecular weight | 19711.21 |
Publications | PubMed=29378020
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19507
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.71| 14| 29| 44| 57| 1
---------------------------------------------------------------------------
44- 57 (21.82/15.74) EKDKELNNAVKELK
75- 88 (22.88/16.80) EKDKKITQVMQILR
---------------------------------------------------------------------------
|