<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19494
| Description |
Uncharacterized protein |
| Sequence | MAICSASILDIKHFGDIMHLFNLAWALVLFLPWFPFSCSFFFLPSMFIFVAQTLPRGPRELSGVVDLISRYKLLPHHDFFCKRPLPLSIADTHYLHNVAGDTEIRKGEGMQLDQLNQNTSHNRDTNARIQPFDFDILKEAFQLRETTPVELPPTEKGLPTIAGKSKGEVKDKERKHKKHKDRDKEKDKEHKKHKHCHKDKDRSKDKDKEKKKDRSGHHGSGADHLKKHHEKKRKHDGDEVRNDINRHKKSKYVDYLLCL |
| Length | 259 |
| Position | Head |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.910 |
| Instability index | 34.27 |
| Isoelectric point | 9.42 |
| Molecular weight | 30236.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.51| 14| 15| 170| 183| 1
---------------------------------------------------------------------------
170- 183 (27.70/10.65) KDKERKHKKH....KDRD
186- 203 (20.58/ 6.35) KDKEHKKHKHchkdKDRS
241- 254 (20.24/ 6.15) RNDINRHKKS....KYVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.17| 11| 19| 206| 216| 2
---------------------------------------------------------------------------
206- 216 (18.93/ 8.20) KDKEKKKDRSG
227- 237 (21.24/10.00) KHHEKKRKHDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.43| 20| 20| 112| 131| 3
---------------------------------------------------------------------------
112- 131 (34.77/21.98) LDQLNQNTSHNRDTNARIQP
134- 153 (31.66/19.49) FDILKEAFQLRETTPVELPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.59| 16| 29| 42| 62| 4
---------------------------------------------------------------------------
42- 62 (23.68/25.25) FLPSMFIFVAQTLPrgpreLS
73- 88 (32.91/19.70) LLPHHDFFCKRPLP.....LS
---------------------------------------------------------------------------
|