<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19465
| Description |
Uncharacterized protein |
| Sequence | MDNIVDSLNSAYQEFVGAAAHVLETKESSAAQKTAATDAALENFKQKWELFRVACDQAEEFVESIKQRIGSECLVDEATGYMAGKSGQHSTGLPPISAVRLEQMSKAVRWLVIELQHGSGNAGGAATHAHPSAPFDARFPEDAAQ |
| Length | 145 |
| Position | Tail |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.319 |
| Instability index | 53.59 |
| Isoelectric point | 5.02 |
| Molecular weight | 15547.09 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19465
No repeats found
No repeats found
|