<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19461
| Description |
Uncharacterized protein |
| Sequence | MATPPVAAGGNFEASPPPPMQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKMTGMEYMLSEVMEPHLFVIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKACTTAASKLEKIGYVDTENESETVEPKGGKEAINIKEVKRVDHILASLQRKLPPAPLPPPFPDGFVPPSTAEAEKDPENQQTAEPQPSAVDPIIDQGPAKRMKF |
| Length | 252 |
| Position | Head |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.415 |
| Instability index | 58.68 |
| Isoelectric point | 5.35 |
| Molecular weight | 28148.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19461
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.10| 11| 187| 16| 26| 1
---------------------------------------------------------------------------
16- 26 (26.57/10.69) PPPPMQPPGTD
201- 211 (25.53/10.02) PPAPLPPPFPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.28| 22| 24| 109| 131| 2
---------------------------------------------------------------------------
109- 131 (35.24/29.49) AEKVTPMLaYYILDGSIYQAPQL
136- 157 (37.04/25.91) AARVGRAL.YYISKACTTAASKL
---------------------------------------------------------------------------
|