<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19460
Description |
Uncharacterized protein |
Sequence | MSAALVKACQVGNGVEGAEEVTFLYRLTPGACPKSQNFWESISTLITVRSHVGMTLVIIARVFPQFDALVAALPPSEGGEKAQLRRFTELQAENDSIGQELQKQLEVAVKELKQVQELFSQAADNCLNLKKLD |
Length | 133 |
Position | Middle |
Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
Kingdom | Viridiplantae |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.044 |
Instability index | 50.69 |
Isoelectric point | 5.22 |
Molecular weight | 14561.56 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19460
No repeats found
No repeats found
|