<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19452
| Description |
Uncharacterized protein |
| Sequence | MDTNNWRSTPPSGEPTMDTGDWRTQLQPDSRQRIVNKIMDTLKRHLPFSGQDGLNELRKIAVRFEEKIFTAATSQSDYLKRISLKMLTMENKSQNTVPNTGNNSKPPDPGSQGMQNQVHSQGQSIPISLQCNQSQAQLLPQSVPNNMASAGVQSSAGLQSGMPAVSGLTQNPVPNVVGQNTNMQNMSGISQNSLGQGMSSNMFANQQRQMPRQQVLPQQQQQQQQQQLYHQQLQNQLIKQKMQQGNLQPSLMQSHMQQQQNLLPPTQLQSSQQSGMQTSSVIQQSSMQSTPLPGLQHNQQSSLQQSSQSMLQQHQQFRQQQQAASSGIHQQQTPMTQQSMMPQQQHQHQPPQPQHQQPHIMGQQNYRCVQNFKVQNY |
| Length | 377 |
| Position | Tail |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.063 |
| Instability index | 81.14 |
| Isoelectric point | 9.95 |
| Molecular weight | 42427.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19452
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.14| 12| 15| 1| 12| 3
---------------------------------------------------------------------------
1- 12 (26.56/16.33) MDTNNWRS..TPPS
17- 30 (21.58/11.95) MDTGDWRTqlQPDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 188.46| 35| 87| 112| 147| 4
---------------------------------------------------------------------------
112- 147 (58.45/17.54) QGM.QNQVHSQGQSIPISLQCNQsQAQLLPQSV.PN.........NM
150- 186 (35.79/ 6.47) AGV.QSSAGLQSGMPAVS........GLTQNPV.PNvvgqntnmqNM
187- 220 (47.61/11.05) SGIsQN...SLGQGMSSNMFANQ.QRQMPRQQVlPQ.........QQ
316- 345 (46.61/10.66) QFR.QQ......QQAASSGIHQQ.QTPMTQQSMmPQ.........QQ
---------------------------------------------------------------------------
|