<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19450
| Description |
Uncharacterized protein |
| Sequence | MGQTPVAMHMSNMISSGMTSSVPLAQTVFSSGQSGMTSLPGSGAVTGTTQVPPNSNLNSFASATSNVAGNSNIGISQPMCNVQGAVSMGQSVPGSMSQGNHSGAQLVQTGVAMSQSMSGLGPSTVSSGTGTLIPASGMSQQVQSGMQTLGVNNNSAASMPLSQQTSSALQSAQSKYVKVWEGNLSGQRQGQPVFITRLEGYRSASASETLASDWPQTMQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLGQLQEKKLCAVIQLPSQTLMLSVSDKAYRLIGMLFPGSYLGASSKLPKFHLNQKILELIKTCHESNLHCCNSLPGHHPSIKTEKDD |
| Length | 338 |
| Position | Unknown |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.200 |
| Instability index | 46.21 |
| Isoelectric point | 9.13 |
| Molecular weight | 35559.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19450
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 63.32| 13| 15| 16| 28| 1
---------------------------------------------------------------------------
16- 28 (22.81/ 8.73) SGMTSSVPLAQTV
34- 45 (21.38/ 7.77) SGMT.SLPGSGAV
127- 138 (19.12/ 6.25) SGTGTLIPASG.M
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.76| 10| 15| 48| 57| 2
---------------------------------------------------------------------------
48- 57 (19.14/11.33) TTQVPPNSNL
64- 73 (17.62/ 9.85) TSNVAGNSNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.37| 27| 43| 97| 123| 4
---------------------------------------------------------------------------
88- 106 (21.14/ 7.10) ......MGQSV....PG.............smSQGNHSGAQL
107- 148 (38.21/19.69) VQTGVAMSQSMSGLGPStvssgtgtlipasgmSQQVQSGMQT
151- 186 (27.03/11.44) VNNNSAASMPLSQQTSS...alqsaqskyvkvWEGNLSG...
---------------------------------------------------------------------------
|