<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19449
| Description |
Uncharacterized protein |
| Sequence | MFESWKSTPDRGSFFFGEGAIDASQDGEKGKSASKHSWNNNISSSLFTTSAIDGRSLPHSFEHLYAISAYAFRQSGATSTFMRGSMISPTLSSSTHCLHHCITLIPCSSMLLMSAALVKAAKQFDALVAALPPSEDGEKAQLRRIAELQAENDAVGQELQKQLEAAVKEVKQVQELFNQAADNCLNLKKPD |
| Length | 191 |
| Position | Middle |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.294 |
| Instability index | 46.27 |
| Isoelectric point | 6.06 |
| Molecular weight | 20756.14 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19449
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.34| 17| 30| 4| 22| 1
---------------------------------------------------------------------------
4- 22 (28.29/23.82) SWKStpDRGSFFFGEGAID
37- 53 (31.06/18.79) SWNN..NISSSLFTTSAID
---------------------------------------------------------------------------
|