<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19448
| Description |
Uncharacterized protein |
| Sequence | MATPPVAPSQAAAGGNFEAPPPPAMQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYGWTCNNEKLRMQSIHPLDISQLSKMTGIEYMLSEVMEPHLFIIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYVDTENESETSEPKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPDGFVPPTTEAEKEPENQQTAEPQPPAVDPIIDQGPAKRMKF |
| Length | 256 |
| Position | Head |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.444 |
| Instability index | 57.53 |
| Isoelectric point | 5.36 |
| Molecular weight | 28559.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.10| 12| 30| 208| 219| 2
---------------------------------------------------------------------------
208- 219 (26.59/ 8.71) APPPPPFPDGFV
235- 246 (23.51/ 7.05) AEPQPPAVDPII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.64| 14| 30| 36| 49| 3
---------------------------------------------------------------------------
36- 49 (28.78/21.21) CFRDQLWLNT.YPLD
67- 81 (22.86/15.51) CNNEKLRMQSiHPLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.13| 11| 25| 114| 125| 4
---------------------------------------------------------------------------
114- 125 (16.93/14.11) AEKVTPMLaYYI
141- 151 (20.20/11.82) AARVGRAL.YYI
---------------------------------------------------------------------------
|