<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19427
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTKESDNASDTPSSPKNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYPHCLYFLELLQNANFRNAMAHPANKEVAHRQQFFFWKNYRNNRLKFILPKPPPEEVPTPAPLPPASAPPQQSLPASNIAMTTAPPAPASTHSPMPYGLPSGSALAKNDMRNSGIDRRKRKHDLKDPDSDEYHFDYHRKEA |
| Length | 216 |
| Position | Middle |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.898 |
| Instability index | 59.96 |
| Isoelectric point | 7.78 |
| Molecular weight | 24939.71 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19427
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 105.20| 25| 28| 31| 57| 1
---------------------------------------------------------------------------
31- 55 (44.06/16.39) FLLEL....EFVQCLANPTYIHYLAQNRY
61- 80 (32.42/12.12) FIGYL....KYLQYWQRPEYPHCL.....
82- 109 (28.72/10.17) .FLELlqnaNFRNAMAHPANKEVAHRQQF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.48| 17| 23| 134| 150| 2
---------------------------------------------------------------------------
134- 150 (34.93/12.91) TPAPLPPAS..APPQQSLP
157- 175 (30.55/10.58) TTAPPAPASthSPMPYGLP
---------------------------------------------------------------------------
|