<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19426
| Description |
Uncharacterized protein |
| Sequence | MVAAKKTKKTHESINNRLALVMKSGKYTLGYKIVFKSLRSSKGQELQKQLEAAVKELKQVQELFSQAADNCLNLKQPD |
| Length | 78 |
| Position | Middle |
| Organism | Gossypium barbadense (Sea-island cotton) (Egyptian cotton) |
| Kingdom | Viridiplantae |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.586 |
| Instability index | 34.14 |
| Isoelectric point | 9.84 |
| Molecular weight | 8794.19 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19426
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.11| 15| 15| 44| 58| 1
---------------------------------------------------------------------------
44- 58 (23.24/13.90) QELQKQLEAAVKELK
61- 75 (25.87/16.06) QELFSQAADNCLNLK
---------------------------------------------------------------------------
|