Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASSQAPPSAPNEGQDNGSREPKYGGYTRFEIELEFVQSLANPNYLNHLAAQKLLQQPAFVAYLKYLQYWSQPPYLKYITYPGPTLKNLELLQQERFRRDIISPDFVAALVQEGTKAAVEWHKEKEV |
Length | 127 |
Position | Middle |
Organism | Diaporthe helianthi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
Aromaticity | 0.13 |
Grand average of hydropathy | -0.603 |
Instability index | 57.43 |
Isoelectric point | 6.11 |
Molecular weight | 14575.29 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19423 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.49| 15| 28| 34| 48| 2 --------------------------------------------------------------------------- 34- 48 (27.11/15.16) LEFVQSLANPNYLNH 64- 78 (30.37/17.69) LKYLQYWSQPPYLKY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PYLKYITYP 2) SREPKYGGYTRFEIELEF 3) YLQYW | 74 19 66 | 82 36 70 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab