<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19410

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMDPGEYDTNTLLINNISSVAFKIYEPVVTHASSYTFSASDVESILRNGGHLVYADATRRAIWCFSLTAVDGSTIGLPTQPYLDANLEVCGYKLMMVEEGGLEPISLLKNRNAPPNTLNTPVSSSPSGSALDSALRGAQAPGGAMATTGFPVESDIKATVGFSVDSKGYGSILAKDIHEFFTAAVLTSISQRFCTKTGAIPLDSRSFILPSSSTESESSEPAGAPIIASLRVHLTTTGSLFLGVSLSFSQGLHAGADGLNSSLPPAGATVLAAPFGVFGTFQGLTEGESSSVDGSAAQSPETQITRFRTDGDTISLQWRATCCKLLEMRGISTAILSRSSWLSIQYLRRKPVESRSDGKRTPVVNSQTHILWPAVLCFRKRTRSQLAMNGTVDPSGISLRDGFDALNHAKNWFTGNSDREELLAKRKNEREAAATKDTSDGNPRLLQNNGSSPFDMRRASNNGATGGAMYPTPPDGVQTVAGVTPSIDGTTSSPGNPAPSAALVDIDTSMTAPGGLGDAFGEGWDGSDTKREQAFIQGENWELNNDVFVDNDITDADFNFFDEHPGSMDVSVPDLSELNTGLPSLGSADTFAAPTPQKPPEHGPAKNNDLPAPPVFAKPELKHARSIIGENRSRDSTKVRPSNGVKRQSSPFDPTAVYKRLKASIAGGFRTNTNSVSLPLRRGSVYDKLQFDPSLSMVNKKYEHSGRFDFQWDNEENTTKKTGSPPTTDYLRRHGKSRATLKDVPANAGSRSMDGAGAMGHGLQLDTIKYEDSTSDADEVSLVSDQDDASEFSDEPSSPTKLSVRRRRLGDDNESLAPSIRDIEFMDDNQTLNSTDLSKLSISDHSEISISRYFADTEPASQRPIPSDDEFIMIAQILTEQAVSGCLKILLPKSVHVGLLSADMQRDIIHGTQNSLRTLQAILPPNLQTATVCQLRQLLEIQDVPFLAAPSRMQPRPAGGPEQRPSLVQIPPPHLELRRQESRLSVLPSAVRFWETLGLGPSQGPKNVHAVCVFPGLDGVADFAGILLERLHNVYESLKLGSFERMPSSANVPNVQNGLFSYEVDRTTNAAVSSPGSQLRSLLVENMAKLAVAIYNSTAVSRNFVIYFVYTPDNPQTIIDACAAFKRLFDIYKRVLAERKKPAQNELVLQLVSLDFMATSTSLVVLHPFEHIRLCLETYDRCTLFGGPMPAPAVVLEQPITRGIDFQIRNPPSANILQENSAMHIAYAQSVDERWITAAWSDNRGSKQMTASYCLGRRGKPLSRGFTDVAHEIWTTTFDLISIWKVHWRIIVTKVGPMDQQEVSDWITLAQTETKASVTLTLLAVDTNPALQLIPAASKIPITAQSAFYSTPVSTPQSSIVSPEQVGNPSTPKGGPTSVQGATTPGADVNASEADTDASLVDVTDTIWAAIASHRLNISHSLVDPNPALISGYLIKRGGSSTEDPPAVLEVNVVHSEGNPRMHELLLREMLTYFRGLCTIARARSVTDEEGDVRPWHVAAAEKGVQALYQLM
Length1511
PositionKinase
OrganismDiaporthe helianthi
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
Aromaticity0.07
Grand average of hydropathy-0.290
Instability index48.43
Isoelectric point5.50
Molecular weight163354.54
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19410
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.59|      12|      14|     954|     965|       1
---------------------------------------------------------------------------
  596-  612 (19.64/ 7.17)	QKPPEHGPAknndlPAP
  957-  972 (19.95/ 7.42)	AGGPEQRPS.lvqiPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     298.24|      92|     238|     481|     588|       2
---------------------------------------------------------------------------
  123-  253 (121.23/64.51)	SSPSGSALDSAL....RGAQAPGGAMATTGFPVE.SDIKATVGFsvdSKGYGSILAKDIheFFTAAVLTSISQRFCTKTGA....IP.LDSRSFILPS..SSTesessepagapiiaslrvhltttgslflgvslsfsqGLHA
  260-  293 (34.55/ 8.67)	SS..LP.PAGATV.....LAAPFGV...FGT.FQGL.TEGESSS...VDG.............................................................................................
  491-  595 (142.47/87.99)	SSPGNPAPSAALVdidTSMTAPGGLGDAFGEGWDGSDTKREQAF...IQGENWELNNDV..FVDNDITDADFNFFDEHPGSmdvsVPdLSELNTGLPSlgSAD.................................tfaAPTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     176.23|      52|     239|      70|     121|       3
---------------------------------------------------------------------------
   70-  121 (90.81/70.20)	DGSTIGLPTQPYLDANLEVCGYKLMMVEEGGLEPISLLKNR..NAPPNTLNTPV
  309-  362 (85.42/65.48)	DGDTISLQWRATCCKLLEMRGISTAILSRSSWLSIQYLRRKpvESRSDGKRTPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.53|      12|      17|     915|     926|       5
---------------------------------------------------------------------------
  915-  926 (21.43/13.39)	LRTLQAILP.PNL
  934-  946 (17.11/ 9.10)	LRQLLEIQDvPFL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.34|      14|      18|     395|     410|      11
---------------------------------------------------------------------------
  395-  410 (19.61/20.39)	GISLRDgfDALNHAKN
  414-  427 (23.73/15.21)	GNSDRE..ELLAKRKN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19410 with Med13 domain of Kingdom Fungi
Unable to open file!