<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19408

Description Transcription mediator subunit Med12
SequenceMRVLSGGGSGLPVLRLCVRARLEFQSTTTPAPRAVWSSPSHSALGTWHLPSSSSQLTSPLTSSPLTSSPGPERRQPAALPTYSTRPGPSPPTRFHLDGAPTPRLAMSSRPPMGVPQRQPPSRSLSGSSSLSQRPAHQRTLSSQYIPSSPIRNNNANSTSSNNNITADFTAEPSSQNSNVTQTQYGTPRRGGSRLRLELSNQCITHSGFIESPTSAGPLDPFKSFAASRPAAPSMSGDMSDLGDMSSPQTSRGPPTADNDNIPLPMPRRRTRFVVSDSRKDVAAPAPAPVKKDIRPKPYTLEVPPAAPRYLVLNASARGDSSSRTGSANAPPTAYADFNPWTGDGPEDHFTQTFIQTGFFDKAPVAQLESSSAKGAIFSSLKHKTGLYALSTVFTGILGSRRHNGQINSASTFKPPPRVTVTDTKRESWLRDLANPTTSLRRLSRTIPHGIRGKGLLEQCLNKNVPTDRAVWLAKCVGANEVRAFKRKGVNGAVVMGGEAKWVRDWTMFVEQFVDGVVSSFEDAEWKTKVNYALRLATHLYAEHLLDREHYMDWLVSGLENCTQAKLPMWLLVTQIYWKDLLRLRKYGRRLVVALLNQNTTIQNHPDNDILAPLSSRITILLRSLMVSSATNFISPSAWAKHRDALSSILPADDELAQAAYRGIHARNEQLLSSVRAPPATRHVIVKMLDGTLQAPMPDDLPTKCWQMSRDQATLARTTLEWSISMYRPGLARIYVACRLLSTWTAFGLDATAAVLDLLNTDPLEELERKNSLYHLVAELVHSGSFDPLIYVQWLIARGGLHDSDSVMRDGPASSRLLVELPLHALSPSLISMRTNMLGRASYSVEDEAKDQDMAINCIKGSLGLHWSPAQESSAIPLGKLCRRVSMSSRSLKVEIGQFIRRTFVQGVPQGQLPGKEGLQLPCSTFNGVRSILEAAEDFQTLADLLKTTTGFHDADILSSSADTLNLHLPVFGALNAAKILFDTLLARLDNMKQIQGLAGTRPLLTSMAMLAPRMPGQDALVNYLNEAIRNDRSSAVDASSPVSDNMAARIQDEEGELLDEIEKRLANKTSMDRTTMNSFLNKIIPKVQACWGTVDERLRAYSSLLTRLRQFDTQHFDSFMTKWVLGIRNPQTRPPLARIFPLMISVGCLNLSIILTTTGDAASSTGSPHPAGKLAGPPSTYVQEVLEMLTTSPTFRDLLTPEEMYRFKILQNQAPKLHLKELVALVRNALSEFCASQARGVAGTAPLADPRAQNRLICFLRMLVLSDQAAVPKMLHSKTLDPAVVQMMDDIATRLLLPHTAEGTRITFDQVLGLANELTLPFCQLKLSHGFGPNDNASGAIAQDRQANQLEIFAKAMDNAIDARNITWTGMLPSLSPEITQHLLTRAQTRFFELLPSKDRPQPPEDSIIVAESLLSVIDTIGRCSPIASRSPLQLASATVDRLAEMWELLALPSESDVKVTVLVTWLPLVLSYLTLQAHVHDAANKASNEIRGRALLVLSGIMQELDGLASLATCDPRIPSNQTVYLIHRVFDVSVILVDTLSDEIRQHCVRILREALSDSRLRYIFSSAPAPLDNLMLSHKDKLATSQQAQGQGSQQGQQQRPRGVGFLGVGAVGGNIWGNAVGPGGHGQEKLSAFTFKRWEILNEPTSNVGENTTSLSLTLFEAIKLH
Length1670
PositionKinase
OrganismDiaporthe helianthi
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
Aromaticity0.06
Grand average of hydropathy-0.229
Instability index48.77
Isoelectric point9.13
Molecular weight182777.56
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19408
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     142.29|      36|     152|     353|     388|       1
---------------------------------------------------------------------------
  353-  388 (60.49/41.32)	FIQTGFFDKAPVAQLESSSAKGAIFSSLKHKTGLYA
  508-  541 (58.56/39.74)	FVEQ.FVDGV.VSSFEDAEWKTKVNYALRLATHLYA
  898-  916 (23.24/10.81)	FIRRTFVQGVPQGQLPGKE.................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     566.20|     124|     384|     918|    1059|       2
---------------------------------------------------------------------------
  918- 1037 (187.92/91.43)	....L.Q..........LPCSTFNGVR....SILEAAEDFQTLA...........DL....LKTTTGFHDADILSS..SADTLNLHLPVFG.....AL..NAA..KILFDTLLARL..DN......MKQIQGLAGTR..PLLTSMAMLAPRMPGQDA.............LV...NYLNEAIRNDRSSAVD
 1151- 1272 (123.39/56.19)	....L.S..........IILTTTGDAA....SSTGSPHPAGKLAgppstyvqevlEM....LTTSPTFR..DLLTP..E......EMYRFK.....ILqnQAP..KLHLKELVALV..RNalsefcASQARGVAGTA..PLAD......PR..AQNR.............LI...CFLRMLVLSDQ.AAVP
 1283- 1428 (138.63/79.10)	AVVQ...mmddiatrllLP.HTAEGTRitfdQVLGLANELTLPF...........CQ....LKLSHGFGPNDNASGaiAQDRQANQLEIFAkamdnAI..DAR..NITWTGMLPSLspEI......TQHLLTRAQTRffELLPSKD..RPQ.PPEDS.............IIvaeSLLSVIDTIGRCSPIA
 1429- 1548 (116.26/56.22)	SRSP.lQ..........LASATVDRLA....EMWELLA.LPSES...........DVkvtvLVTWLPL....VLSY..L..TLQAH..VHD.....AA..NKAsnEIRGRALLVLS..GI......MQELDGLA.........SLATCDPRIPSNQTvylihrvfdvsviLV...DTLSDEIRQ.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.01|      17|      23|      71|      93|       3
---------------------------------------------------------------------------
   76-   93 (29.43/14.32)	PAALPTYSTrPGPSPPTR
  106-  122 (32.58/ 8.72)	MSSRPPMGV.PQRQPPSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     120.27|      34|      74|     229|     262|       4
---------------------------------------------------------------------------
  229-  262 (66.45/30.32)	PAAPS.MSGDMSDLGDMSS.PQTSRGPPTADNDNIP
  304-  339 (53.81/23.26)	PAAPRyLVLNASARGDSSSrTGSANAPPTAYADFNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.96|      23|     384|      26|      53|       5
---------------------------------------------------------------------------
   40-   66 (34.07/21.78)	SHSALGTWHLPSSSsqltSPL..................TSSP..LT
  425-  471 (19.89/ 8.84)	RESWLRDLANPTTSlrrlSRTiphgirgkglleqclnknVPTDraVW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.87|      21|     428|     264|     295|       6
---------------------------------------------------------------------------
  268-  288 (38.31/36.44)	RRTRFVVSDSR.KDVAAPAPAP
 1552- 1573 (33.56/ 7.72)	RILREALSDSRlRYIFSSAPAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.79|      11|     238|     550|     560|       8
---------------------------------------------------------------------------
  550-  560 (22.31/12.18)	YMDWLVS..GLEN
  790-  802 (17.48/ 8.08)	YVQWLIArgGLHD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19408 with Med12 domain of Kingdom Fungi
Unable to open file!