<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19406

Description Serine/threonine-protein kinase SSN3
SequenceMTNPPSVASQGSGGTQTYPKSILKKSVQAAFEGETHTITTSSSSFITTTTNLLPPATIPDTSPSSSSYSSPPPPPPPPPPPPPLLLSLLDLLGPIFIISMMNSSASSRQYGLARQSSGLQGRPGLSRQGSSSYPSDRGFGPVGYQSKVRVIDRYKVIGFISSGTYGRVYKAVGRQGQPGEFAIKKFKPDKEGEVVTYTGISQSAVREMALCSELSHHNIIKVHEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATIKSIMFQLLNGSQYLHANWVLHRDLKPANIMVTSGGEIKIGDLGLARMFQKPLHSLYSGDKVVVTIWYRAPELLLGSRHYTPAIDMWALGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLVHMPEYGSLSQLQPPLTHHHHHGGGGGGGGGGRGHHGGHHHSQQQPAGSQLDKWYNSTISTSTGTSAPNGGPSSLASLGQEGYKLLAGLLEYDPERRLTAAQALQHPFFATGPDKVSANCFEGLKVEYPHRRVSQDDNDIRTSSLPGTKRSGLPDDSLVHPGKRVKQDG
Length572
PositionKinase
OrganismDiaporthe helianthi
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe.
Aromaticity0.07
Grand average of hydropathy-0.420
Instability index47.08
Isoelectric point9.25
Molecular weight62300.08
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19406
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.00|      19|      22|      42|      63|       1
---------------------------------------------------------------------------
   42-   63 (30.07/17.53)	SSSFITTTTnllPPATIPDTSP
   65-   83 (42.94/19.18)	SSSYSSPPP...PPPPPPPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.77|       9|      36|     491|     500|       2
---------------------------------------------------------------------------
  491-  500 (14.46/11.71)	GL.LEYdPERR
  526-  535 (15.31/ 6.87)	GLkVEY.PHRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.73|      26|      44|     116|     141|       3
---------------------------------------------------------------------------
  116-  141 (49.28/26.59)	SSGLQGR..PGLSRQGSSSYPSDRGFGP
  161-  188 (43.45/22.57)	SSGTYGRvyKAVGRQGQPGEFAIKKFKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.62|      31|      36|     405|     435|       4
---------------------------------------------------------------------------
  405-  435 (60.91/33.19)	HMPEYGSLSQLQPPLTHHHHHGGGGGGGGGG
  444-  474 (55.71/29.68)	HSQQQPAGSQLDKWYNSTISTSTGTSAPNGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.33|      11|      22|     213|     223|       5
---------------------------------------------------------------------------
  213-  223 (19.35/12.33)	ELSHHNIIK.VH
  237-  248 (14.97/ 8.00)	EYAEHDLLQiIH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19406 with CDK8 domain of Kingdom Fungi
Unable to open file!