Description | Uncharacterized protein |
Sequence | MERNQPAAAASLLDQEGKIIAEILTSYRDLVNFATEPITNKTSTGQASYNSMAMDLETQTLIKSVENLLSLTRRIRELWITGPLRKPGEGDRTEETIGSEVQQVVAILNQLRSNKRRQLVSEGGGYGQFEVGDLARPPQPNMAGAPGPASTPAPMSGGTAPQAGEMA |
Length | 167 |
Position | Head |
Organism | Diaporthe helianthi |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.459 |
Instability index | 51.81 |
Isoelectric point | 5.10 |
Molecular weight | 17894.95 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19405 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) FEVGDLAR 2) RIRELWI | 129 74 | 136 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab