| Description | Uncharacterized protein |
| Sequence | MERNQPAAAASLLDQEGKIIAEILTSYRDLVNFATEPITNKTSTGQASYNSMAMDLETQTLIKSVENLLSLTRRIRELWITGPLRKPGEGDRTEETIGSEVQQVVAILNQLRSNKRRQLVSEGGGYGQFEVGDLARPPQPNMAGAPGPASTPAPMSGGTAPQAGEMA |
| Length | 167 |
| Position | Head |
| Organism | Diaporthe helianthi |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Diaporthales> Diaporthaceae> Diaporthe. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.459 |
| Instability index | 51.81 |
| Isoelectric point | 5.10 |
| Molecular weight | 17894.95 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP19405 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FEVGDLAR 2) RIRELWI | 129 74 | 136 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab