<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19392
Description |
Mediator of RNA polymerase II transcription subunit |
Sequence | MEEKAVNALTVTNPKTTQELAMEGQKHLEDTIEAAFKILSSMNDELCNPALWSTTSSSSSPPPPPPPSSATPAANGLSNGGVVNGDASSSDNASAHHHGELGGSGGASGGAGGPLAEAQFRYRNAVASLRAILSAIPTSSQRGGAFETATGSLSQAEQVEIENLEERASNLRKELANKNSYLKILIDQLRDLITDISMWQSPCSV |
Length | 205 |
Position | Head |
Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.392 |
Instability index | 46.06 |
Isoelectric point | 4.88 |
Molecular weight | 21331.30 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19392
No repeats found
No repeats found
|