<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19385
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASGKDSDDSAESPSSPKSIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQQPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQFYYWKNYRNNRLKHILPRTLPPEPPAPAPPQQAVPPVTASTISMTAASAPVLSPMQYANPPGSSLAKTDMRNSGVDRRKRKKDG |
| Length | 198 |
| Position | Middle |
| Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.710 |
| Instability index | 60.14 |
| Isoelectric point | 9.11 |
| Molecular weight | 22761.58 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19385
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.04| 18| 18| 48| 65| 1
---------------------------------------------------------------------------
28- 41 (16.32/ 7.06) ....RQRFLLELEFVQCL
48- 65 (32.79/19.99) HYLAQNRYFEDEAFIGYL
69- 82 (23.94/13.05) QYWQQPEYIK...FIMY.
---------------------------------------------------------------------------
|