<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19370
Description |
Uncharacterized protein |
Sequence | MDLEAKRFGRGPRELGGAVDLINQYKLWPHYESFCRRSIPLSITATHYLHNVVGNTEIRRGEGMELDQLFQNAIHLRKRDADIHLFDLNVLSDAFRMRETTSVNIPLGIPTAMAKLKSELKEKEKKHKSKAKKDHKKHKSRHKDNSSHKKRRLDGVEDLPFHGNKRVVIENPKIIEMGKLKVKINHCRSGLPICLVVTHSHDFLHVS |
Length | 207 |
Position | Head |
Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.690 |
Instability index | 50.96 |
Isoelectric point | 9.85 |
Molecular weight | 23884.41 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19370
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.59| 11| 89| 59| 71| 2
---------------------------------------------------------------------------
59- 69 (18.92/17.51) RRGEGMELDQL
78- 88 (18.67/ 7.80) KRDADIHLFDL
---------------------------------------------------------------------------
|