<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19364
Description |
Mediator of RNA polymerase II transcription subunit |
Sequence | MDNMVDTLNNAYQEFVGAAANVLEAKESSVAQKTLSTDAALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATGSVAGKSCGSGSTSASAATGLPPISAVRLEQMSKAVRWLVIELQHGSGSSAGSAAHSHPSAAPFDARFTEDSAQ |
Length | 153 |
Position | Tail |
Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.224 |
Instability index | 48.37 |
Isoelectric point | 4.79 |
Molecular weight | 16083.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19364
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.83| 15| 50| 80| 94| 1
---------------------------------------------------------------------------
80- 94 (26.91/13.56) GSVAGKSCGSGSTSA
127- 141 (26.92/13.57) GSSAGSAAHSHPSAA
---------------------------------------------------------------------------
|