<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19359
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MASLASRLFEVSPNRSLWLTAFRGTLPTFLSSSSSTPLDSSPSSTKEILALFTSLQTQLFEAVAQLQEILDLQDTKSKVACETKSKDAALLAFAHKVKEAERVLDILVDDYSDYRRPKRSKLDEDAAKDEDEDEDEEEDDDDNLTTTTVASRLNLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQEEQMRASQLYNFASLDVGLPKIVESEEKAVEPMVEPPVPLPAAAEPIPLSSLAAIQGLLHPNITVPSGWKPGMPVELPSELPLPPPGWKPGDPVPLPPLASLPVPRVGEQQLRSKQPEPIQVRHVQLDIIDQDDDSSDYSSDDGSSEDDD |
| Length | 341 |
| Position | Middle |
| Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.452 |
| Instability index | 72.62 |
| Isoelectric point | 4.34 |
| Molecular weight | 37215.07 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.40| 28| 53| 209| 239| 1
---------------------------------------------------------------------------
209- 237 (48.59/28.15) GL..PKI.VESEEKAVEPmVEPP..VPLPAAA.EP
248- 281 (40.81/14.18) GLlhPNItVPSGWKPGMP.VELPseLPLPPPGwKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.35| 13| 190| 129| 141| 2
---------------------------------------------------------------------------
129- 141 (23.78/11.85) DEDEDEDEEEDDD
329- 341 (23.57/11.69) DYSSDDGSSEDDD
---------------------------------------------------------------------------
|