<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19358

Description Transcription elongation factor
SequenceMDYDDLRTILDSSGVDVWTLIDTAIAVASMDYGGDLKKRRDGIVERLYAATATSSAPASATTTTAGFRSFDADQSSHSPPRQYDRDAKASAGKERVSPATPRSVGGEEDEDNEDGRLDPYGGLFDDEQKRVLEIKEHLEDPDQSEDSLVGLLQTLADMDITFQALRETDIGRHVNRLRKHSSNEVRRLVKQLVRKWKDIVDEWVKFNQPGEHASAIMDGDSPPQKIPQNGHHQVPDFAYSPNPHNGSSGSDKNSEPERKPKAVPPRREAPPKPATPSVPQPHSAPQNRQREQKESNFDLEKLASARKRLQANYKEAENAKKQRTIQVMDIHEIPKPKSKTGFFPKNKGASGGSMGRHW
Length358
PositionUnknown
OrganismTrema orientale (Charcoal tree) (Celtis orientalis)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Cannabaceae> Trema.
Aromaticity0.06
Grand average of hydropathy-1.039
Instability index53.03
Isoelectric point6.44
Molecular weight39888.65
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
translation elongation factor activity	GO:0003746	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19358
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     131.09|      38|     172|      69|     127|       1
---------------------------------------------------------------------------
   78-  116 (63.57/30.19)	SPPRQYDRDAKASAGKERVSPaTPRSVGGEEDEDNEDGR
  221-  258 (67.52/19.91)	SPPQKIPQNGHHQVPDFAYSP.NPHNGSSGSDKNSEPER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.51|      15|      85|      30|      45|       2
---------------------------------------------------------------------------
    1-   15 (26.70/15.67)	MDY.DDLRTILDSSGV
   30-   45 (22.81/17.90)	MDYgGDLKKRRDGIVE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19358 with Med26 domain of Kingdom Viridiplantae
Unable to open file!