<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19357
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYKDYLQDPKSAPAPPPPIEGTYVCFGGTYTTDDVLPSLEEQGLRQLYPKGPNIDFKKELRSLNRELQLQILELADVLVERPSQYARRVEDISLIFKNLHHLLNSIRPHQARATLIHILELQILHRKQAVEDIKRRREEAQRLLKGSLGAFDAH |
| Length | 168 |
| Position | Middle |
| Organism | Trema orientale (Charcoal tree) (Celtis orientalis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Trema.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.546 |
| Instability index | 73.23 |
| Isoelectric point | 8.63 |
| Molecular weight | 19361.00 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.58| 29| 45| 79| 111| 2
---------------------------------------------------------------------------
79- 108 (43.10/40.41) RELQLQILELaDVL........VERPSQYARRVEDISL
126- 162 (39.47/22.84) RATLIHILEL.QILhrkqavedIKRRREEAQRLLKGSL
---------------------------------------------------------------------------
|