<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19342
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSSQSAAAGTGVNSGNGVMFPQANDTAAAATTAVAEEAKQNLNQVINSIQKTLGLIHQLNLTVSTFNAASQLPLLHRLNSLVSELDNMVKLSEKCNIQVPMEVLNLIDDGKNPDEFTKDVINSCIAKNQITKGKTDAFKGLRKHLLEELEMTFPDEVESYREIRAASAAEFKRQAQAQAQSMMPNGDVKVKNEV |
| Length | 195 |
| Position | Middle |
| Organism | Parasponia andersonii (Sponia andersonii) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.342 |
| Instability index | 31.34 |
| Isoelectric point | 5.26 |
| Molecular weight | 21173.72 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19342
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.89| 15| 16| 54| 68| 1
---------------------------------------------------------------------------
54- 68 (24.76/19.24) LGLIHQLNLTVSTFN
73- 87 (24.13/18.58) LPLLHRLNSLVSELD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.84| 11| 20| 106| 117| 2
---------------------------------------------------------------------------
106- 117 (16.46/15.20) NLIDDGKNpDEF
129- 139 (20.37/12.44) NQITKGKT.DAF
---------------------------------------------------------------------------
|