<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19338
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGKDSDDSAESPSSPKNIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQQPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQFYYWKNYRNNRLKHILPRTLPPEPPALAPASAPPQQAVPPVTASTIPMTVAPAPVLSPMQYANPPGSSLAKTDMRNSGVDRRKRKKDG |
Length | 202 |
Position | Middle |
Organism | Parasponia andersonii (Sponia andersonii) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.672 |
Instability index | 62.71 |
Isoelectric point | 9.11 |
Molecular weight | 23179.13 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19338
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.66| 22| 22| 133| 154| 1
---------------------------------------------------------------------------
133- 154 (43.73/19.26) TLPPEPPALAPAS..APPQQAVPP
156- 179 (38.93/16.48) TASTIPMTVAPAPvlSPMQYANPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.04| 18| 18| 48| 65| 2
---------------------------------------------------------------------------
28- 41 (16.32/ 8.20) ....RQRFLLELEFVQCL
48- 65 (32.79/23.47) HYLAQNRYFEDEAFIGYL
69- 82 (23.94/15.27) QYWQQPEYIK...FIMY.
---------------------------------------------------------------------------
|