<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19320
Description |
Mediator complex |
Sequence | MATPPVGGAAGMEGGGPPVAPPPPGTDMTGICFRDQLWLNSYPLDRNLVFDYFALSPFYDWTCNNEHLRMRSIHPLDLSQLSKMTGIEYMLSEVMEPHLFVIRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKSEKIGYVDSENESAAVESKIGKETIDFKEVKRIDHILGSLQRKLPPAPPPPPFPEGYVPLTATESENGPEALQVGDAQPPALDPIIDQGPAKRMRF |
Length | 253 |
Position | Head |
Organism | Parasponia andersonii (Sponia andersonii) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.329 |
Instability index | 56.96 |
Isoelectric point | 5.46 |
Molecular weight | 27941.70 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19320
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.21| 14| 29| 32| 45| 3
---------------------------------------------------------------------------
32- 45 (29.00/19.68) CFRDQLWLNS.YPLD
63- 77 (22.20/13.41) CNNEHLRMRSiHPLD
---------------------------------------------------------------------------
|