<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19309
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MELPYGGGSGGGGSWTMIPNVQTHSSVSTPSNQDSLYLHQQQFQPQQQFQPQQSPLYQQQQRLLLHQQPQQQQQQPQQQHHHQSLASHFRLFHLVEKLGEAIENGNRDQQSDALINDLNNHFDKCRQLLNSISGSLSTKAMTVEGQKRKLEESEQMLNQRRDLINKYIKSVEELVKSEP |
Length | 179 |
Position | Middle |
Organism | Parasponia andersonii (Sponia andersonii) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -1.052 |
Instability index | 66.80 |
Isoelectric point | 6.49 |
Molecular weight | 20577.55 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19309
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.60| 22| 24| 30| 53| 1
---------------------------------------------------------------------------
30- 53 (36.96/21.64) P..SNQDSLYLHQQQfQPQQQfQPQQ
55- 78 (40.64/16.02) PlyQQQQRLLLHQQP.QQQQQ.QPQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.12| 10| 26| 121| 130| 2
---------------------------------------------------------------------------
121- 130 (18.84/13.40) HFDKCRQLLN
149- 158 (16.27/10.67) KLEESEQMLN
---------------------------------------------------------------------------
|