<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19304
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MATATYPPPPPYYRLYKDYLQDPKSAPAPPPPIEGTYVCFGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLQILELADVLVERPSQYARRVEDISLIFKNLHHLLNSIRPHQARATLIHILELQILHRKQAVEDIKRRREEAQRLLKESLGAFDAH |
Length | 168 |
Position | Middle |
Organism | Parasponia andersonii (Sponia andersonii) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.563 |
Instability index | 73.74 |
Isoelectric point | 7.87 |
Molecular weight | 19419.04 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19304
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.99| 29| 45| 79| 112| 2
---------------------------------------------------------------------------
79- 108 (42.99/38.59) RELQLQILELaDVL........VERPSQYARRVEDISL
126- 162 (39.00/20.28) RATLIHILEL.QILhrkqavedIKRRREEAQRLLKESL
---------------------------------------------------------------------------
|