<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19304
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATATYPPPPPYYRLYKDYLQDPKSAPAPPPPIEGTYVCFGGTYTTDDVLPSLEEQGVRQLYPKGPNIDFKKELRSLNRELQLQILELADVLVERPSQYARRVEDISLIFKNLHHLLNSIRPHQARATLIHILELQILHRKQAVEDIKRRREEAQRLLKESLGAFDAH |
| Length | 168 |
| Position | Middle |
| Organism | Parasponia andersonii (Sponia andersonii) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.563 |
| Instability index | 73.74 |
| Isoelectric point | 7.87 |
| Molecular weight | 19419.04 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19304
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.99| 29| 45| 79| 112| 2
---------------------------------------------------------------------------
79- 108 (42.99/38.59) RELQLQILELaDVL........VERPSQYARRVEDISL
126- 162 (39.00/20.28) RATLIHILEL.QILhrkqavedIKRRREEAQRLLKESL
---------------------------------------------------------------------------
|