<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19302
| Description |
Mediator of RNA polymerase II transcription subunit |
| Sequence | MQQLQLQHQQPQVATTTAAMAIQNAAVQTQSSGGSNSTEAPPKQVAQAMDRLSHAARLIADIRLGADRLLEALFVAAQPHQSNKPLQLFQNEDASMRQHLQDLRSIGKQLEESGVLSESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHLDDDGQNGTQDTEPNVKKPRGPEVVAASHLEELSDCKTLSDILTRLEKEVPNLKILTYERMDWLKRASSLPSSANESPIETLKEHNFHSSNRLKPGPLSDVAADKVAVIELSFPSVFRAVVSLHPAGSIDPDAVAFFSPDEGGSYMHARGVSVYHVFRHITVMYFFVCFMFILVLDVEAL |
| Length | 358 |
| Position | Tail |
| Organism | Parasponia andersonii (Sponia andersonii) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.272 |
| Instability index | 52.31 |
| Isoelectric point | 6.35 |
| Molecular weight | 39470.32 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19302
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.20| 19| 27| 265| 285| 2
---------------------------------------------------------------------------
265- 285 (27.58/22.89) FHSSNRLKPGplSDVAADKVA
295- 313 (32.63/19.72) FRAVVSLHPA..GSIDPDAVA
---------------------------------------------------------------------------
|