<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19302

Description Mediator of RNA polymerase II transcription subunit
SequenceMQQLQLQHQQPQVATTTAAMAIQNAAVQTQSSGGSNSTEAPPKQVAQAMDRLSHAARLIADIRLGADRLLEALFVAAQPHQSNKPLQLFQNEDASMRQHLQDLRSIGKQLEESGVLSESLRSRSNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHLDDDGQNGTQDTEPNVKKPRGPEVVAASHLEELSDCKTLSDILTRLEKEVPNLKILTYERMDWLKRASSLPSSANESPIETLKEHNFHSSNRLKPGPLSDVAADKVAVIELSFPSVFRAVVSLHPAGSIDPDAVAFFSPDEGGSYMHARGVSVYHVFRHITVMYFFVCFMFILVLDVEAL
Length358
PositionTail
OrganismParasponia andersonii (Sponia andersonii)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Cannabaceae> Parasponia.
Aromaticity0.06
Grand average of hydropathy-0.272
Instability index52.31
Isoelectric point6.35
Molecular weight39470.32
Publications

Function

Annotated function
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP19302
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.20|      19|      27|     265|     285|       2
---------------------------------------------------------------------------
  265-  285 (27.58/22.89)	FHSSNRLKPGplSDVAADKVA
  295-  313 (32.63/19.72)	FRAVVSLHPA..GSIDPDAVA
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP19302 with Med27 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MQQLQLQHQQPQVATTTAAMAIQNAAVQTQSSGGSNSTEAPPKQVAQAMD
1
50

Molecular Recognition Features

MoRF SequenceStartStop
NANANA